|
Register | Sign In |
|
QuickSearch
EvC Forum active members: 64 (9164 total) |
| |
ChatGPT | |
Total: 916,901 Year: 4,158/9,624 Month: 1,029/974 Week: 356/286 Day: 12/65 Hour: 0/0 |
Thread ▼ Details |
|
Thread Info
|
|
|
Author | Topic: Discussion of Phylogenetic Methods | |||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: So in other words.... cytochrome B isn't something you want to show off when trying to sell evolution to people... so you cherry-pick cytochrome C instead. That isn't true at all. The higher rate of change in the cytB gene means it is more useful for more closely related species.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
vaporwave writes: This is a really interesting subject, but don't you find it strange that evolutionists are so quick to wander into teleology when making their case for common ancestry? I thought it was strictly all about the science with you guys? I seems in every defense of evolution I've heard, within 3 or 4 posts the evolutionists are always making implications about what God would or wouldn't do...
Is this an admission that creationism is incapable of making any predictions about what we should or shouldn't observe?
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: Cladistics actually works just fine without assuming common ancestry. The point we are making is that only common ancestry can explain why species fit into clades. You have been incapable of explaining why creationism would produce clades, such as the mammal clade that humans belong to.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
vaporwave writes: But I think if an individual coder designed many variations of a web browser in short span of time, then it could pretty easily be interpreted as an evolutionary pattern. How so? Why would an individual coder produce code so that it falls into a nested hierarchy?
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: Higher variation = increased deviation from a phylogenetic signal or pattern. No, it doesn't. It means a loss of phylogenetic signal for distantly related species. "There is one caveat to consider with this prediction: if rates of evolution are fast, then cladistic information can be lost over time since it would be essentially randomized. The faster the rate, the less time needed to obliterate information about the historical branching pattern of evolution."29+ Evidences for Macroevolution: Part 1 This is why strongly conserved sequences of DNA are used for phylogenetic reconstruction of species that share a distant common ancestor. For more closely related species, the phylogenetic signal in the cytB gene is still there. For more distantly related species, the phylogenetic signal in cytC is still there. We could use a crime scene as an analogy. If an expert shows up at a crime scene within hours of a murder then the expert can collect evidence such as fresh tire tracks, fresh shoe prints, and so forth. If the expert shows up weeks after a murder that evidence will be gone, but there will still be other evidence such as DNA and fingerprint evidence. Just because some evidence has disappeared does not make all of the evidence disappear.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: Only if you assume shared traits are the product of common inheritance. The traits themselves don't show you that. The pattern of shared derived characteristics (i.e. an objective phylogeny) do show us that they share a common ancestor in the same way that a fingerprint shows us that someone touched a surface.
Are you under the impression that templates can only be used exclusively of each other? You can't use more than one when building something? That would be a bizarre thing to assume from a design perspective. Isn't that the impression you have been pushing all along? If a designer can mix and match design units freely, then creationism should not produce a nested hierarchy.
I haven't said anything about creationist models, but it sounds like you're suggesting that one cannot group objects by shared traits (cladistics) unless those objects are related via common ancestry. Is that really what you're saying? We are saying that only common ancestry is able to explain why shared derived characteristics found in biological species form an objective phylogeny. Creationism can't explain it.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
dwise1 writes: But wait, there's more! In software, we can also reach in, rip out whole sections of code, and replace it with completely foreign code. That is probably the most important point. You can take modules from several other programs and meld them into a new program. This would produce numerous and obvious violations of a nested hierarchy. Contrary to vaporwave's claims, if we took the tools we use to analyze phylogenies in biological species and applied them to software we would not conclude that software evolved through common ancestry and vertical inheritance.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
caffeine writes: The issue here is not missing data - we have a lot of genes to work with. Do we? For those frogs, what percentage of their genomes have been sequenced? How much phylogenetic coverage is there? If the divergence is ancient and you don't have lots of sister taxa coverage, then you might not have enough data. The deeper the node the more difficult it is to preserve a phylogenetic signal without sufficient coverage (at least from what I have read).
I have never seen anyone argue that an absence of phylogenetic signal implies that the organisms being studied are unrelated To use an analogy, even though no one has found Jimmy Hoffa's body no one believes he was snagged by aliens and transported to another galaxy. We are pretty sure that humans are involved. In the same vein, we are extremely confident that these frogs evolved from a common ancestor.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: So when sequence data reinforces a preferred evolutionary relationship you assume it was well-conserved. We OBSERVE that it is well conserved due to the number of shared bases. There are no assumptions. It is a direct observation.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
vaporwave writes: Yes, but nothing in that statement necessitates evolutionary history. It is evidence for an evolutionary history. Also, your inability to explain this data using creationism further reinforces this conclusion.
That's just the way you automatically think about traits when you assume evolution is true. Linnaeus did not assume evolution in the 1700's, and he came to the same conclusion. The nested hierarchy is an observation, and creationism can't explain it. Evolution can.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
vaporwave writes: I don't think you should take the analogy quite so literally. Human programmers change design scope on the fly and obviously screw things up all the time, usually like you say, not anticipating what kind of effect a new feature will have on the rest of the program. If you set this fallibility aside then my point still stands, a dominant "evolutionary" pattern emerges.
What "dominant evolutionary pattern"? Why would a single programmer build several programs in a way that they would form an evolutionary pattern?
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: If a coder wants to design, say, a hundred variations of a web browser program, he would probably work off some sort of common coding base for the basic program and then add/remove/tweak various peripheral features in order to generate variety. Such a collection of programs would easily fall into a nested hierarchy, and would have the effect of a phylogenetic signal similar to evolution.
Why would it fall into a nested hierarchy? Let's say there are 5 different peripherals, A through E. A programmer could create these 5 programs with 2 peripherals each: 1. A, C2. B, E 3. A, B 4. A, E 5. B, C I can almost guarantee that those programs would not produce a nested hierarchy. There is absolutely no reason why a programmer would produce code that falls into a nested hierarchy because that programmer is able to mix and match peripherals in a manner that easily violates a nested hierarchy.
Not necessarily. Evolutionists might simply argue the species are still closely related but the genes were not conserved in their lineages. Do you not understand what conservation of sequence is? You line up the sequences and see how many positions in the gene have the same base. It is an observation, not a conclusion.
Phylogenies are not objective. For example, subjective weighting of characters as either homologous or independent convergences is a huge issue in systematics. You can't subjectively weigh a DNA base.
Yes, if you assume common ancestry is true, then that's exactly what phylogenies do. A phylogeny is evidence that common ancestry is true. It isn't an assumption. Do you have to assume that a suspect is guilty in order to get a DNA match? No. The DNA match is what evidences guilt. The same process works with phylogenies and common ancestry. The phylogeny is evidence of common ancestry.
Crude example: start with a vertebrate template, and from a vertebrate template generate a vertebrate-tetrapod template and a vertebrate-fish template, and so on. I'm not sure what your obsession is with this hypothetical mix-and-match scenario. I may as well be disparaging the common ancestry assumption because evolution could potentially have evolved different lifeforms at different times and it didn't.
Why not a vertebrate-cephalopod template? Why not a mammal-bird template? Why not a fish-jellyfish template? All of these would violate a nested hierarchy, but there is nothing stopping a designer from making them.
Well then you have problems because you don't have an objective phylogeny. "The degree to which a given phylogeny displays a unique, well-supported, objective nested hierarchy can be rigorously quantified. Several different statistical tests have been developed for determining whether a phylogeny has a subjective or objective nested hierarchy, or whether a given nested hierarchy could have been generated by a chance process instead of a genealogical process (Swofford 1996, p. 504). These tests measure the degree of "cladistic hierarchical structure" (also known as the "phylogenetic signal") in a phylogeny, and phylogenies based upon true genealogical processes give high values of hierarchical structure, whereas subjective phylogenies that have only apparent hierarchical structure (like a phylogeny of cars, for example) give low values (Archie 1989; Faith and Cranston 1991; Farris 1989; Felsenstein 1985; Hillis 1991; Hillis and Huelsenbeck 1992; Huelsenbeck et al. 2001; Klassen et al. 1991). "29+ Evidences for Macroevolution: Part 1
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
There seems to be some confusion over what sequence conservation is. I will be using protein sequences here, since they are a 3rd the length of DNA sequences.
Here is a comparison of human and chimp cytochrome B:
355/379(94%) Query 1 MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS 60 MTP RK NPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS Sbjct 1 MTPTRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS 60 Query 61 TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL 120 TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLY ETWNIGIILL Sbjct 61 TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYLETWNIGIILL 120 Query 121 LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT 180 L TMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQW+WGGYSVDSPTLTRFFT Sbjct 121 LTTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWVWGGYSVDSPTLTRFFT 180 Query 181 FHFILPfiiaalatlhllflhETGSNNPLGITSHSDKITFHPYYTIKDAlglllfllslm 240 FHFILPFII AL TLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKD LGL LFLL LM Sbjct 181 FHFILPFIITALTTLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDILGLFLFLLILM 240 Query 241 tltlfsPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVlalllsili 300 TLTLFSP LLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRS+PNKLGGVLALLLSILI Sbjct 241 TLTLFSPGLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSIPNKLGGVLALLLSILI 300 Query 301 lamipilHMSKQQSMMFRPLSQSlywllaadlliltwiGGQPVSYPFTIIGQVASVLYFT 360 L IP+LH SKQQSMMFRPLSQ LYWLLA DLLILTWIGGQPVSYPF IGQ+ASVLYFT Sbjct 301 LTAIPVLHTSKQQSMMFRPLSQLLYWLLATDLLILTWIGGQPVSYPFITIGQMASVLYFT 360 Query 361 TILILMPTISLIENKMLKW 379 TILILMP SLIENKML+W Sbjct 361 TILILMPIASLIENKMLEW 379 Here is a comparison of human and chimpanzee cytochrome c (somatic)
105/105(100%) Query 1 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW Sbjct 1 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60 Query 61 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Sbjct 61 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 Human and chimp cytochrome B is 95% conserved. Human and chimp cytochrome C is 100% conserved. We get these numbers by directly comparing the sequences. We say that cytochrome C is more conserved because 100% is greater than 95%. We do not change these values based on phylogenetic data. Any questions?
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1 |
caffeine writes: I'm taking issue with the point I've seen Taq and others make more than once on these forums, that phylogenetics by itself is a test of common ancestry. Since we don't reject common ancestry when we cannot produce a well supported phylogeny, it seems dishonest to say we're testing evolution this way. But we do produce well supported phylogenies all over the place. I have already cited the cytochrome c example.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
vaporwave writes: Yes, though so many evolutionists believe that it would be impossible to generate phylogenetic trees in the first place if common ancestry was false... You have been incapable of explaining why something other than common ancestry would necessarily produce a nested hierarchy. If you can't come up with a logical and valid reason why a process other than common ancestry would necessarily produce a nested hierarchy, then our point stands.
I actually think common ancestry is a reasonable assumption, just not nearly as strong as evolutionists make it out to be. Their whole schtick is selling the idea that common ancestry is scientifically ironclad and beyond reasonable doubt, which it isn't. Doesn't change the fact that all of the evidence supports common ancestry.
|
|
|
Do Nothing Button
Copyright 2001-2023 by EvC Forum, All Rights Reserved
Version 4.2
Innovative software from Qwixotic © 2024