|
Register | Sign In |
|
QuickSearch
EvC Forum active members: 64 (9164 total) |
| |
ChatGPT | |
Total: 916,902 Year: 4,159/9,624 Month: 1,030/974 Week: 357/286 Day: 0/13 Hour: 0/0 |
Thread ▼ Details |
|
Thread Info
|
|
|
Author | Topic: Can mutation and selection increase information? | |||||||||||||||||||||||||||||||||||||||
Pressie Member Posts: 2103 From: Pretoria, SA Joined: |
How do you measure genetic information to try and determine whether there was an increase or decrease?
|
|||||||||||||||||||||||||||||||||||||||
Tangle Member Posts: 9514 From: UK Joined: Member Rating: 4.8 |
CRR writes: Incorrect Would you like me to copy and paste the quotes from the likes of Faith and Dredge and inumerable others that pass through this place? Really? The problem you creationists have is that you all believe different things....Je suis Charlie. Je suis Ahmed. Je suis Juif. Je suis Parisien. I am Mancunian. I am Brum. I am London. "Life, don't talk to me about life" - Marvin the Paranoid Android "Science adjusts it's views based on what's observed.Faith is the denial of observation so that Belief can be preserved." - Tim Minchin, in his beat poem, Storm.
|
|||||||||||||||||||||||||||||||||||||||
CRR Member (Idle past 2271 days) Posts: 579 From: Australia Joined: |
The problem you evolutionists have is that you all have different definitions of what evolution and the ToE are. You all believe different things.
Go ahead and copy/paste as many quotes from whoever you like, I already know I don't agree with Faith and Dredge on everything.
|
|||||||||||||||||||||||||||||||||||||||
Tangle Member Posts: 9514 From: UK Joined: Member Rating: 4.8
|
CRR writes: The problem you evolutionists have is that you all have different definitions of what evolution and the ToE are. You all believe different things. Out of all the definitions of evolution you've been given show me any that are contradictory. Want me to try the same with creationism?
Go ahead and copy/paste as many quotes from whoever you like, I already know I don't agree with Faith and Dredge on everything. Now show me where anyone that argues for evolution here disagrees on anything significant.Je suis Charlie. Je suis Ahmed. Je suis Juif. Je suis Parisien. I am Mancunian. I am Brum. I am London. "Life, don't talk to me about life" - Marvin the Paranoid Android "Science adjusts it's views based on what's observed.Faith is the denial of observation so that Belief can be preserved." - Tim Minchin, in his beat poem, Storm.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
CRR writes: The problem you evolutionists have is that you all have different definitions of what evolution and the ToE are. You all believe different things. Every time you use this argument it is a transparent attempt to avoid the evidence or a question you don't like.
|
|||||||||||||||||||||||||||||||||||||||
RAZD Member (Idle past 1434 days) Posts: 20714 From: the other end of the sidewalk Joined: |
Out of all the definitions of evolution you've been given show me any that are contradictory. Show me any that don't mean essentially the same thing. All I've seen are definitions of evolution that are like synonyms of words -- saying the same thing a slightly different way. The consilience between them providing a more complete picture than any one definition.
Now show me where anyone that argues for evolution here disagrees on anything significant. In science ... in politics not so difficult. by our ability to understand Rebel☮American☆Zen☯Deist ... to learn ... to think ... to live ... to laugh ... to share. Join the effort to solve medical problems, AIDS/HIV, Cancer and more with Team EvC! (click)
|
|||||||||||||||||||||||||||||||||||||||
CRR Member (Idle past 2271 days) Posts: 579 From: Australia Joined: |
Tangle writes: Who says?
Yes, it's a good example of a beneficial mutation followed by natural selection creating a change to the phenotype of a population - evolution in action, observed and proven. This is something creationists claim can't happen. quote:Dr Robert Carter, mutations-new-information - creation.com quote:Alex Williams, Beneficial mutations real or imaginary part 1 - creation.com quote:Dr. Georgia Purdom, Are There Beneficial Mutations? | Answers in Genesis I could give examples from the Discovery Institute but they don't count because they're not Creationists.
|
|||||||||||||||||||||||||||||||||||||||
Pressie Member Posts: 2103 From: Pretoria, SA Joined:
|
Ah, I see CRR is starting to get it.
The first quote provided.
Can mutations produce new information? Yes, depending on what you mean by ‘new’ and ‘information’... Great. If you could quantify genetic information it would be quite easy. Which of these two have more genetic information; a cow or a pig?
|
|||||||||||||||||||||||||||||||||||||||
Tangle Member Posts: 9514 From: UK Joined: Member Rating: 4.8 |
CRR writes: I could give examples from the Discovery Institute but they don't count because they're not Creationists. This is all great news CRR, some creationists are beginning to accept evolutionary theory. Perhaps you could pass this knowledge onto Faith and Dredge here, it would save a lot of time. Meanwhile are elephants and tapirs the same kind and why are pigs and cows not?Je suis Charlie. Je suis Ahmed. Je suis Juif. Je suis Parisien. I am Mancunian. I am Brum. I am London. "Life, don't talk to me about life" - Marvin the Paranoid Android "Science adjusts it's views based on what's observed.Faith is the denial of observation so that Belief can be preserved." - Tim Minchin, in his beat poem, Storm.
|
|||||||||||||||||||||||||||||||||||||||
Pressie Member Posts: 2103 From: Pretoria, SA Joined: |
Don't forget about Petromus. Do they have more or less genetic information than cows or pigs?
Edited by Pressie, : No reason given.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
CRR writes: Who says? Science is not a religion, so quotes from scientists carry no weight. There is no scripture in science. You need to present evidence, not quotes.
|
|||||||||||||||||||||||||||||||||||||||
Vlad Junior Member (Idle past 2456 days) Posts: 27 Joined: |
I see, guys, you prefer blah-blah to model experiments. Well, this is quite understandable Still I continue along my line of argument.
Once again, chance mutations are able to create new heritable (and meaning) information — in principle. Yet, it is known that the truth is in measure. Indeed, until the process of lexical self-replication operates within the area of comparatively simple forms — say, birth, suite, etc. — it faces no insuperable difficulties in its creative activities. Then consider the advanced form evolution: the clone evolution would be able to sooner or later accidentally "gemmate" the new form revolution. And here the awkward question suggests itself: are chance mutations able to create even more complex forms? Would spontaneous evolution be able to originate such form as, for instance, counterrevolutionary? Or any other 20-character English noun?
|
|||||||||||||||||||||||||||||||||||||||
Pressie Member Posts: 2103 From: Pretoria, SA Joined: |
Vlad writes: Nope. The other way round. I, personally, prefer data above blah-blah-blah. Then you, Vlad, keep on going with nothing but word salads. I see, guys, you prefer blah-blah to model experiments. Edited by Pressie, : No reason given.
|
|||||||||||||||||||||||||||||||||||||||
New Cat's Eye Inactive Member |
I see, guys, you prefer blah-blah to model experiments. Ha! That's rich coming from a guy who goes on to use scare-quotes eight times.
Would spontaneous evolution be able to originate such form as, for instance, counterrevolutionary? Or any other 20-character English noun? Words don't reproduce.
|
|||||||||||||||||||||||||||||||||||||||
Taq Member Posts: 10085 Joined: Member Rating: 5.1
|
Vlad writes: Would spontaneous evolution be able to originate such form as, for instance, counterrevolutionary? Or any other 20-character English noun? Here is the amino acid sequence for human cytochrome c, an active and functional enzyme: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Do you see any 20-character English nouns? Edited by Taq, : No reason given.
|
|
|
Do Nothing Button
Copyright 2001-2023 by EvC Forum, All Rights Reserved
Version 4.2
Innovative software from Qwixotic © 2024